Product Information
15408-1-PBS targets ATP5E in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7672 Product name: Recombinant human ATP5E protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC001690 Sequence: MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE Predict reactive species |
| Full Name | ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit |
| Calculated Molecular Weight | 6 kDa |
| Observed Molecular Weight | 6 kDa |
| GenBank Accession Number | BC001690 |
| Gene Symbol | ATP5E |
| Gene ID (NCBI) | 514 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P56381 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ATP synthase epsilon subunit (ATP5E) is an important subunit of ATP synthase, which is located in the stalk region of the F1 sector. F1-ATPase is the catalytic portion of mitochondrial ATP synthase, which produces ATP from ADP and inorganic phosphate (Pi). ATP5E is widely expressed in tissues. The calculated molecular weight of ATP5E is 6 kDa (PMID: 36625260).





