ATP5G3 Polyclonal antibody, PBS Only

• 

  IHC staining of human ovary tumor using 21662-1-AP (same clone as 21662-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21662-1-AP (ATP5G3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21662-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 21662-1-AP (same clone as 21662-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21662-1-AP (ATP5G3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21662-1-PBS in a different storage buffer formulation.

ATP5G3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21662-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

21662-1-PBS targets ATP5G3 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16406

  Product name: Recombinant human ATP5G3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-60 aa of BC106881

  Sequence: MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREF

• Full Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9)
• Calculated Molecular Weight: 142 aa, 15 kDa
• GenBank Accession Number: BC106881
• Gene Symbol: ATP5G3
• Gene ID (NCBI): 518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48201
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP5G3, also known as ATP5MC3, belongs to the ATPase C chain family. ATP5G3 encodes subunit 9 (ATPase subunit c), which is a subunit of the multi-subunit enzyme that catalyzes ATP synthesis during oxidative phosphorylation in mitochondria. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The subunit c is a component of the proton channel proteins in the F0 portion of the enzyme.