ATP6V0D1 Polyclonal antibody

• 

  WB analysis using 18274-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18274-1-AP (ATP6V0D1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 18274-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 18274-1-AP (ATP6V0D1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 18274-1-AP

  IP result of anti-ATP6V0D1 (IP:18274-1-AP, 4ug; Detection:18274-1-AP 1:4000) with mouse testis tissue lysate 1120 ug.

• 

  IHC staining of human kidney using 18274-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18274-1-AP (ATP6V0D1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 18274-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18274-1-AP (ATP6V0D1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 18274-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18274-1-AP (ATP6V0D1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 18274-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18274-1-AP (ATP6V0D1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 18274-1-AP

  Immunofluorescent analysis of HeLa cells using 18274-1-AP (ATP6V0D1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 18274-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using ATP6V0D1 antibody (18274-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

ATP6V0D1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18274-1-AP

Publications(24)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

V ATPase subunit d 1, V ATPase AC39 subunit, p39, ATP6DV, ATP6D

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human placenta tissue, HeLa cells, mouse kidney tissue, mouse testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: mouse kidney tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 21 publications below
• IHC: See 1 publications below
• IF: See 6 publications below
• IP: See 2 publications below

Product Information

18274-1-AP targets ATP6V0D1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13002

  Product name: Recombinant human ATP6V0D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC008861

  Sequence: MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF

• Full Name: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
• Calculated Molecular Weight: 351 aa, 40 kDa
• Observed Molecular Weight: 37-41 kDa
• GenBank Accession Number: BC008861
• Gene Symbol: ATP6V0D1
• Gene ID (NCBI): 9114
• RRID: AB_2258877
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61421
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP6V0D1(V-type proton ATPase subunit d 1) is also named as ATP6D, VPATPD and belongs to the V-ATPase V0D/AC39 subunit family.It is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Nat Metab; Time of exercise differentially impacts bone growth in mice; Authors - Shaoling Yu
human	WB	Autophagy; Follicular lymphoma-associated mutations in the V-ATPase chaperone VMA21 activate autophagy creating a targetable dependency; Authors - Fangyang Wang
mouse	WB	Autophagy; Disruption of the vacuolar-type H(+)-ATPase complex in liver causes MTORC1-independent accumulation of autophagic vacuoles and lysosomes.; Authors - Sandra Kissing
human	WB	Mol Ther; Caspase-8 Induces Lysosome-Associated Cell Death in Cancer Cells.; Authors - Benfu Zhong
mouse	WB	Cell Mol Life Sci; The Ncoa7 locus regulates V-ATPase formation and function, neurodevelopment and behaviour.; Authors - Enrico Castroflorio
		Cells; A Role for the V0 Sector of the V-ATPase in Neuroexocytosis: Exogenous V0d Blocks Complexin and SNARE Interactions with V0c; Authors - Christian Lévêque

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Zakia (Verified Customer) (05-22-2024)

we are using this for our lab, Works great,

• Applications: Western Blot, Immunohistochemistry
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: N2A,293T cells, ReNcells

ATP6V0D1 Antibody Western Blot,Immunohistochemistry validation (1:500 dilution) in N2A,293T cells, ReNcells (Cat no:18274-1-AP)