CoraLite® Plus 488-conjugated ATP6V0D1 Polyclonal antibody

• 

  IF Staining of HeLa using CL488-18274

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 ATP6V0D1 antibody (CL488-18274) at dilution of 1:200, CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

ATP6V0D1 Polyclonal Antibody for IF/ICC

Cat No. CL488-18274

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

32 kDa accessory protein, ATP6D, ATP6DV, ATP6V0D1, P39, V ATPase AC39 subunit, V ATPase subunit d 1, VATX, VMA6, VPATPD

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-18274 targets ATP6V0D1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13002

  Product name: Recombinant human ATP6V0D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC008861

  Sequence: MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF

• Full Name: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
• Calculated Molecular Weight: 351 aa, 40 kDa
• Observed Molecular Weight: 37-41 kDa
• GenBank Accession Number: BC008861
• Gene Symbol: ATP6V0D1
• Gene ID (NCBI): 9114
• RRID: AB_3672693
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61421
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ATP6V0D1(V-type proton ATPase subunit d 1) is also named as ATP6D, VPATPD and belongs to the V-ATPase V0D/AC39 subunit family.It is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.