Tested Applications
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | mouse brain tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31697-1-AP targets ATP8A2 in IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36276 Product name: Recombinant human ATP8A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1085-1188 aa of NM_001313741 Sequence: EDVAWRAAKHTCKKTLLEEVQELETKSRVLGKAVLRDSNGKRLNERDRLIKRLGRKTPPTLFRGSSLQQGVPHGYAFSQEEHGAVSQEEVIRAYDTTKKKSRKK Predict reactive species |
| Full Name | ATPase, aminophospholipid transporter-like, class I, type 8A, member 2 |
| Calculated Molecular Weight | 133kDa |
| Observed Molecular Weight | 129 kDa |
| GenBank Accession Number | NM_001313741 |
| Gene Symbol | ATP8A2 |
| Gene ID (NCBI) | 51761 |
| RRID | AB_3670083 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9NTI2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATP8A2 is also known as ATPIB. ATP8A2 is a member of the P4‐ATPase subfamily of P‐type ATPases that actively flips phosphatidylserine (PS) and phosphatidylethanolamine (PE) across membranes to generate and maintain transmembrane phospholipid asymmetry, a property important in such cellular processes as vesicle trafficking, apoptosis, cytokinesis, neuron survival, blood coagulation, and phagocytosis. ATP8A2 consists of an N‐domain involved in binding ATP, a P‐domain that undergoes phosphorylation, an A‐domain that functions in the dephosphorylation of the phosphorylated intermediate, and an M‐domain consisting of 10 transmembrane segments that comprise the pathway for translocation of the lipid across the membrane. ATP8A2 is highly expressed in the brain, spinal cord, testis, and retina (PMID: 33565221, PMID: 33766557, PMID: 37635783).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ATP8A2 antibody 31697-1-AP | Download protocol |
| IP protocol for ATP8A2 antibody 31697-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









