ATXN3L Polyclonal antibody

• 

  WB analysis of human testis using 25099-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 25099-1-AP (ATXN3L Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 25099-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25099-1-AP (ATXN3L Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

ATXN3L Polyclonal Antibody for WB, ELISA

Cat No. 25099-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

ataxin 3 like, ATX3L, ATXN3L, MJDL, Putative ataxin 3 like protein

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25099-1-AP targets ATXN3L in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18740

  Product name: Recombinant human ATXN3L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 271-341 aa of BC137186

  Sequence: CVTPASEQPKKIKEDYFEKHQQEQKQQQQQSDLPGHSSYLHERPTTSSRAIESDLSDDISEDTVQAAVDTI

• Full Name: ataxin 3-like
• Calculated Molecular Weight: 355 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC137186
• Gene Symbol: ATXN3L
• Gene ID (NCBI): 92552
• RRID: AB_2879896
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3M9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATXN3L also named as ataxin 3 like or MJDL is a 355 amino acid protein, which contains one Josephin domain and two UIM repeats. ATXN3L localizes in nucleus and may cleave poly ubiquitin chain.