AUP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AUP1 Polyclonal antibody (13726-1-AP)

AUP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13726-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ancient ubiquitous protein 1, Lipid droplet-regulating VLDL assembly factor AUP1

• 

  WB analysis of K-562 using 13726-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13726-1-AP (AUP1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 13726-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13726-1-AP (AUP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 13726-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13726-1-AP (AUP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 13726-1-AP

  IP result of anti-AUP1 (IP:13726-1-AP, 3ug; Detection:13726-1-AP 1:500) with HEK-293 cells lysate 880ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 13726-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13726-1-AP (AUP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 13726-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using AUP1 antibody (13726-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AUP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, HEK-293 cells, Jurkat cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13726-1-AP targets AUP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4680

  Product name: Recombinant human AUP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 134-437 aa of BC033646

  Sequence: LLTTCSTPLLNSPPSFVCWSRGFMEMNGRGELVESLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPTASASKFPSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD

• Full Name: ancient ubiquitous protein 1
• Calculated Molecular Weight: 416 aa, 45 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC033646
• Gene Symbol: AUP1
• Gene ID (NCBI): 550
• RRID: AB_2258768
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y679
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AUP1 (Ancient ubiquitous protein 1) is a protein associated with lipid metabolism, which is widely expressed on the surface of ER and Lipid droplets, involved in the degradation of misfolded proteins through autophagy (PMID: 37029364). In addition, AUP1 also controls lipid synthesis as it induces ubiquitination and the subsequent degradation of several key regulators of lipid biosynthesis, such as the cholesterol biosynthetic enzyme 3-hydroxy-3-methylglutaryl-coenzyme A reductase (PMID: 28330944).

Publications

What published studies show

The anti-AUP1 antibody (Cat# 13726-1-AP) has 9 citations published in journals including Molecular Cell, Nature Communications, mBio, Molecular Biology of the Cell, Computational and Structural Biotechnology Journal, BBA Molecular and Cell Biology of Lipids, PLoS One, and bioRxiv. Research fields span ER-associated degradation (ERAD), STING-mediated innate immunity, ER stress, hepatic lipid metabolism, lipid droplet proteomics, and noncoding RNA–splicing interactions.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Mol Cell; Genome-wide CRISPR Analysis Identifies Substrate-Specific Conjugation Modules in ER-Associated Degradation.; Authors - Dara E Leto
human	WB	mBio; AUP1 and UBE2G2 complex targets STING signaling and regulates virus-induced innate immunity; Authors - Xin-Tao Wang
human	WB,IF	Comput Struct Biotechnol J; Featured interactome of homocysteine-inducible endoplasmic reticulum protein uncovers novel binding partners in response to ER stress; Authors - Rui Su
zebrafish	WB	Biochim Biophys Acta Mol Cell Biol Lipids; The role of ancient ubiquitous protein 1 (Aup1) in regulating hepatic lipid droplet levels, endoplasmic reticulum stress, and inflammation in zebrafish (Danio rerio); Authors - Shuangyang Xu
human	WB	Mol Biol Cell; Lipid disequilibrium disrupts ER proteostasis by impairing ERAD substrate glycan trimming and dislocation.; Authors - Milton To
human	WB	Mol Biol Cell; A VCP inhibitor substrate trapping approach (VISTA) enables proteomic profiling of endogenous ERAD substrates.; Authors - Edmond Y Huang