AUP1 Polyclonal antibody

• 

  WB analysis of K-562 using 13726-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13726-1-AP (AUP1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 13726-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13726-1-AP (AUP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 13726-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13726-1-AP (AUP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 13726-1-AP

  IP result of anti-AUP1 (IP:13726-1-AP, 3ug; Detection:13726-1-AP 1:500) with HEK-293 cells lysate 880ug.

• 

  IHC staining of mouse brain using 13726-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13726-1-AP (AUP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 13726-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using AUP1 antibody (13726-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

AUP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13726-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ancient ubiquitous protein 1, Lipid droplet-regulating VLDL assembly factor AUP1

---

Tested Applications

• Positive WB detected in: K-562 cells, HEK-293 cells, Jurkat cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IF: See 1 publications below

Product Information

13726-1-AP targets AUP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4680

  Product name: Recombinant human AUP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 134-437 aa of BC033646

  Sequence: LLTTCSTPLLNSPPSFVCWSRGFMEMNGRGELVESLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPTASASKFPSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD

• Full Name: ancient ubiquitous protein 1
• Calculated Molecular Weight: 416 aa, 45 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC033646
• Gene Symbol: AUP1
• Gene ID (NCBI): 550
• RRID: AB_2258768
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y679
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AUP1 (Ancient ubiquitous protein 1) is a protein associated with lipid metabolism, which is widely expressed on the surface of ER and Lipid droplets, involved in the degradation of misfolded proteins through autophagy (PMID: 37029364). In addition, AUP1 also controls lipid synthesis as it induces ubiquitination and the subsequent degradation of several key regulators of lipid biosynthesis, such as the cholesterol biosynthetic enzyme 3-hydroxy-3-methylglutaryl-coenzyme A reductase (PMID: 28330944).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Biol Cell; Lipid disequilibrium disrupts ER proteostasis by impairing ERAD substrate glycan trimming and dislocation.; Authors - Milton To
human	WB	PLoS One; Chlamydia trachomatis Infection Leads to Defined Alterations to the Lipid Droplet Proteome in Epithelial Cells.; Authors - Hector Alex Saka
human	WB	Mol Biol Cell; A VCP inhibitor substrate trapping approach (VISTA) enables proteomic profiling of endogenous ERAD substrates.; Authors - Edmond Y Huang
human	WB	bioRxiv; Cancer-associated snaR-A noncoding RNA interacts with core splicing machinery and disrupts processing of mRNA subpopulations; Authors - Sihang Zhou
human	WB	mBio; AUP1 and UBE2G2 complex targets STING signaling and regulates virus-induced innate immunity; Authors - Xin-Tao Wang
human		Mol Cell; Genome-wide CRISPR Analysis Identifies Substrate-Specific Conjugation Modules in ER-Associated Degradation.; Authors - Dara E Leto