AXUD1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse thymus using 18162-1-AP (same clone as 18162-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 18162-1-AP (AXUD1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18162-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 18162-1-AP (same clone as 18162-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18162-1-AP (AXUD1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18162-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 18162-1-AP (same clone as 18162-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18162-1-AP (AXUD1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18162-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AXUD1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18162-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

18162-1-PBS targets AXUD1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6158

  Product name: Recombinant human AXUD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 239-589 aa of BC038949

  Sequence: CHCDRICDPETCSCSLAGIKCQMDHTAFPCGCCREGCENPMGRVEFNQARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAKPPMNNELGDNSCSSDMTDSSTASSSASGTSEAPDCPTHPGLPGPGFQPGVDDDSLARILSFSDSDFGGEEEEEEEGSVGNLDNLSCFHPADIFGTSDPGGLASWTHSYSGCSFTSGILDENANLDASCFLNGGLEGSREGSLPGTSVPPSMDAGRSSSVDLSLSSCDSFELLQALPDYSLGPHYTSQKVSDSLDNIEAPHFPLPGLSPPGDASSCFLESLMGFSEPAAEALDPFIDSQFEDTVPASLMEPVPV

• Full Name: AXIN1 up-regulated 1
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 64-70 kDa
• GenBank Accession Number: BC038949
• Gene Symbol: AXUD1
• Gene ID (NCBI): 64651
• RRID: AB_10695045
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96S65
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.