Mouse Adiponectin Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83070-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83070-1-RR against Mouse Adiponectin were performed. The affinity constant is 1.46 nM.

Adiponectin Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83070-1-PBS

Clone No.230258B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Adipoq, 230258B2, Acrp30, adipo, apM1

---

Product Information

83070-1-PBS targets Adiponectin in Cytometric bead array, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0262

  Product name: Recombinant Mouse Adiponectin protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 18-247 aa of NM_009605

  Sequence: EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

• Full Name: adiponectin, C1Q and collagen domain containing
• Calculated Molecular Weight: 27kd
• GenBank Accession Number: NM_009605
• Gene Symbol: Adiponectin
• Gene ID (NCBI): 11450
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q60994
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.