Angiopoietin 1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68618-1-Ig (same clone as 68618-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68618-1-Ig (ANGPT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68618-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HUVEC using 68618-1-Ig (same clone as 68618-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HUVEC cells using Angiopoietin 1 antibody (68618-1-Ig, Clone: 3C4A3 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 68618-1-PBS in a different storage buffer formulation.

Angiopoietin 1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68618-1-PBS

Clone No.3C4A3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ANGPT1, ANG-1, ANG1, ANG 1, AGPT

---

Product Information

68618-1-PBS targets Angiopoietin 1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18829

  Product name: Recombinant human ANGPT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 161-293 aa of BC152411

  Sequence: IQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAG

• Full Name: angiopoietin 1
• Calculated Molecular Weight: 498 aa, 58 kDa
• Observed Molecular Weight: 70 kDa, 55 kDa
• GenBank Accession Number: BC152411
• Gene Symbol: Angiopoietin 1
• Gene ID (NCBI): 284
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15389
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Angiopoietin 1 is a 70-kDa secreted glycoprotein generated from vascular mural cells, pericytes, and certain other cells. Angiopoietin 1 participates in vascular differentiation through angiogenesis, which is the process of the growth and remodelling of existing vessels. Angiopoietin 1 is also involved in the maintenance and turnover of blood vessels in mature animals. Angiopoietin 1 binds to and activates the TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation, playing an important role in the regulation of angiogenesis. Overexpression of Angiopoietin 1 has been proven to occur in malignant glioblastoma, neuroblastoma, non-small cell lung cancer, and other tumors.