Mouse ANGPTL4 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP02218-1

  Sandwich ELISA standard curve of MP02218-1, mouse ANGPTL4 Recombinant Matched Antibody Pair - PBS only. 86006-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2770. 86006-1-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  Sample test of MP02218-1

  The mean ANGPTL4 concentration was determined to be 5,803.8 pg/mL in mouse liver extract based on a 3.70 mg/mL extract load.

• 

  Sample test of MP02218-1

  One mouse lung was cultured for 18 hours in RPMI 1640 supplemented with 10% fetal bovine serum, 50 μM β-mercaptoethanol, 2 mM L-glutamine, and 100 μg/mL of streptomycin sulfate. An aliquot of the cell culture supernate was removed, assayed for mouse ANGPTL4, and measured 268.5 pg/mL.

ANGPTL4 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 86006-2-PBS

Clone No.250335A5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

425O18-1, Angiopoietin-like protein 4, Angiopoietin-related protein 4, ANGPTL4 C-terminal chain, ANGPTL4 N-terminal chain

---

Product Information

86006-2-PBS targets ANGPTL4 as part of a matched antibody pair:

MP02218-1: 86006-2-PBS capture and 86006-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2770

  Product name: Recombinant Mouse ANGPTL4 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 168-410 aa of NM_020581.2

  Sequence: RLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

• Full Name: angiopoietin-like 4
• Calculated Molecular Weight: 46 kDa
• GenBank Accession Number: NM_020581.2
• Gene Symbol: Angptl4
• Gene ID (NCBI): 57875
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Z1P8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.