Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Biotin-conjugated Ataxin 2 Polyclonal antibody

Ataxin 2 Polyclonal Antibody for IHC

Cat No. Biotin-21776

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC

ATXN2, ataxin2, Ataxin-2, ATX2, ATXN 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-21776 targets Ataxin 2 in IHC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16470

Product name: Recombinant human Ataxin 2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 251-600 aa of BC114546

Sequence: GSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSS

Predict reactive species
Full Name ataxin 2
Calculated Molecular Weight 1313 aa, 140 kDa
GenBank Accession NumberBC114546
Gene Symbol ATXN2
Gene ID (NCBI) 6311
RRIDAB_2883061
Conjugate Biotin
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99700
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Background

 ATXN2 (Ataxin-2) is a eukaryotic RNA‐binding protein that is conserved across species. It contains two LSm domains (RNA binding), a PAM2 motif (association with poly(A)-binding protein), and an N-terminal polyglutamine tract (PMID: 25027299). Ataxin-2 plays crucial roles at different stages of the regulation of posttranslational gene expression. ATXN2 is also directly implicated in the regulation of neural function by influencing specific molecular and cellular pathways. Genetic expansion of a poly‐glutamine tract in human ATXN2 has been linked to several neurodegenerative diseases, where it most likely acts through gain‐of‐function effects.

 What is the molecular weight of ATXN2? 

 The molecular weight varies from 12 to 140 kDa, depending on the isoform.

 What are the isoforms of ATXN2?

 ATXN2 has many isoforms, which differ significantly in length and domain composition.

 What is the subcellular localization of ATXN2?

 According to siRNA-based experiments, it is localized in the cytoplasmic compartment of normal cells, where it mostly associates with the Golgi apparatus and stress granules (PMID: 22508507).

 What is the tissue specificity of ATXN2?

 ATXN2 protein has been detected in various tissues; however, it is most highly expressed and studied in CNS. Significant amounts of this protein can also be detected in the liver and gallbladder.

 What is the molecular function of ATXN2?

 Ataxin-2 is involved in regulating various steps of mRNA translation, including poly‐A tailing, RNA stabilization, microRNA‐dependent gene silencing, and translational activation. All those functions are linked to its interactions with the poly(A)-binding protein. Ataxin-2 is involved in the formation of stress granules and P-bodies. Furthermore, genetic models of ATXN2 loss‐of‐function have underlined the importance of ATXN2 in mTOR signaling and cellular metabolism, which are all crucial for neural homeostasis (PMID: 29869836).

 What is ATXN2's involvement in disease?

 The N-terminal region of ATXN2 normally contains a polyQ stretch of 14-31 residues that can be expanded in the pathogenic state to 32-200 residues. Intermediate length expansions of this tract increase susceptibility to amyotrophic lateral sclerosis (ALS or Lou Gehrig's disease) (PMID: 20740007). Long expansions of this tract result in spinocerebellar ataxia-2 (SCA2), an autosomal dominantly inherited, neurodegenerative disorder (PMID: 29427103). Genome-wide association studies indicate that loss-of-function mutations in this gene are associated with susceptibility to type I diabetes, obesity, and hypertension.


Protocols

Product Specific Protocols
IHC protocol for Biotin Ataxin 2 antibody Biotin-21776Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...