B4GALNT2 Polyclonal antibody

• 

  WB analysis of Jurkat using 24024-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24024-1-AP (B4GALNT2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 24024-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 24024-1-AP (B4GALNT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 24024-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 24024-1-AP (B4GALNT2 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 24024-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 24024-1-AP (B4GALNT2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon using 24024-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 24024-1-AP (B4GALNT2 Antibody) at dilution of 1:50 (under 10x lens).

B4GALNT2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24024-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

UDP-GalNAc:Neu5Aca2-3Galb-R b1,4-N-acetylgalactosaminyltransferase, Sd(a) beta-1,4-GalNAc transferase, GALGT2, EC:2.4.1.-, Beta-1,4 N-acetylgalactosaminyltransferase 2

---

Tested Applications

• Positive WB detected in: Jurkat cells, COLO 320 cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:600-1:2400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24024-1-AP targets B4GALNT2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21166

  Product name: Recombinant human B4GALNT2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 497-566 aa of BC113677

  Sequence: HSEFFIDGLGTLLVGSCPEVIIGHQSRSPVVDSELAALEKTYNTYRSNTLTRVQFKLALHYFKNHLQCAA

• Full Name: beta-1,4-N-acetyl-galactosaminyl transferase 2
• Calculated Molecular Weight: 566 aa, 63 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC113677
• Gene Symbol: B4GALNT2
• Gene ID (NCBI): 124872
• RRID: AB_2879405
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8NHY0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

B4GALNT2, also named as GALGT2, catalyzes the last step in the biosynthesis of the human Sd(a) antigen, which is found on more than 90% of Caucasian red blood cells. It also catalyzes the last step in the biosynthesis of the Cad antigen, which is related both serologically and biochemically to the Sd(a) antigen. B4GALNT2 transfers a beta-1,4-linked GalNAc to the galactose residue of an alpha-2,3-sialylated chain. This antibody detects the 55-65 kDa B4GALNT2 protein.