Tested Applications
Positive WB detected in | Jurkat cells, COLO 320 cells |
Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24024-1-AP targets B4GALNT2 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21166 Product name: Recombinant human B4GALNT2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 497-566 aa of BC113677 Sequence: HSEFFIDGLGTLLVGSCPEVIIGHQSRSPVVDSELAALEKTYNTYRSNTLTRVQFKLALHYFKNHLQCAA Predict reactive species |
Full Name | beta-1,4-N-acetyl-galactosaminyl transferase 2 |
Calculated Molecular Weight | 566 aa, 63 kDa |
Observed Molecular Weight | 65 kDa |
GenBank Accession Number | BC113677 |
Gene Symbol | B4GALNT2 |
Gene ID (NCBI) | 124872 |
RRID | AB_2879405 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | Q8NHY0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
B4GALNT2, also named as GALGT2, catalyzes the last step in the biosynthesis of the human Sd(a) antigen, which is found on more than 90% of Caucasian red blood cells. It also catalyzes the last step in the biosynthesis of the Cad antigen, which is related both serologically and biochemically to the Sd(a) antigen. B4GALNT2 transfers a beta-1,4-linked GalNAc to the galactose residue of an alpha-2,3-sialylated chain. This antibody detects the 55-65 kDa B4GALNT2 protein.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for B4GALNT2 antibody 24024-1-AP | Download protocol |
IHC protocol for B4GALNT2 antibody 24024-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |