Tested Applications
| Positive WB detected in | HT-29 cells, mouse kidney tissue, mouse lung tissue, mouse thymus tissue, rat kidney tissue, rat thymus tissue, mouse cerebellum tissue |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30478-1-AP targets B4GALT4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32337 Product name: Recombinant human B4GALT4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 39-142 aa of BC004523 Sequence: QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLE Predict reactive species |
| Full Name | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 |
| Calculated Molecular Weight | 40 kDa |
| Observed Molecular Weight | 34-40 kDa |
| GenBank Accession Number | BC004523 |
| Gene Symbol | B4GALT4 |
| Gene ID (NCBI) | 8702 |
| RRID | AB_3086331 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60513 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for B4GALT4 antibody 30478-1-AP | Download protocol |
| WB protocol for B4GALT4 antibody 30478-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



