B7-H4 Recombinant monoclonal antibody

• 

  WB analysis using 86484-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86484-1-RR (B7-H4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

B7-H4 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86484-1-RR

Clone No.250392C3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

B7H4, B7S1, B7x, V-set domain-containing T-cell activation inhibitor 1, Vtcn1

---

Tested Applications

• Positive WB detected in: rat liver tissue, rat uterus tissue, rat pancreas tissue, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86484-1-RR targets B7-H4 in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3230

  Product name: Recombinant Rat B7-H4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 29-257 aa of NM_001024244.1

  Sequence: FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNSG

• Full Name: V-set domain containing T cell activation inhibitor 1
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: NM_001024244.1
• Gene Symbol: Vtcn1
• Gene ID (NCBI): 295322
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q501W4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

B7-H4, also named VTCN1, B7X, or B7S1, is a single-pass type I membrane protein, which contains two immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7-H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7-H4 is over-expressed in many cancers, including breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. The predicted molecular weight of B7‑H4 is 31 kDa. The glycosylated B7‑H4 is 50 to 80 kDa, and the non-glycosylated form is 28 kDa.