Rat B7-H4 Recombinant monoclonal antibody, PBS Only (Capture)

B7-H4 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA
Cat No. 86484-1-PBS
Clone No.250392C3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

B7H4, B7S1, B7x, V-set domain-containing T-cell activation inhibitor 1, Vtcn1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86484-1-PBS targets B7-H4 as part of a matched antibody pair:

MP02632-1: 86484-1-PBS capture and 86484-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3230

Product name: Recombinant Rat B7-H4 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 29-257 aa of NM_001024244.1

Sequence: FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNSG

Predict reactive species
Full Name V-set domain containing T cell activation inhibitor 1
Calculated Molecular Weight31 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberNM_001024244.1
Gene Symbol Vtcn1
Gene ID (NCBI) 295322
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ501W4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

B7-H4, also named VTCN1, B7X, or B7S1, is a single-pass type I membrane protein, which contains two immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7-H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7-H4 is over-expressed in many cancers, including breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. The predicted molecular weight of B7‑H4 is 31 kDa. The glycosylated B7‑H4 is 50 to 80 kDa, and the non-glycosylated form is 28 kDa.

Loading...
||
New chat Able
正在加载,请稍候...