Rat B7-H4 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86484-1-RR (same clone as 86484-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86484-1-RR (B7-H4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86484-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02632-1

  The mean B7-H4 concentration was determined to be 23.71 ng/mL in rat liver extract based on a 8.20 mg/mL extract load and 16.72 ng/mL in mouse uterus extract based on a 3.40 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02632-1

  Sandwich ELISA standard curve of MP02632-1, Rat B7-H4 Recombinant Matched Antibody Pair - PBS only. 86484-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg3230. 86484-2-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

B7-H4 Uni-rAb^® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 86484-1-PBS

Clone No.250392C3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

Synonyms

B7H4, B7S1, B7x, V-set domain-containing T-cell activation inhibitor 1, Vtcn1

---

Product Information

86484-1-PBS targets B7-H4 as part of a matched antibody pair:

MP02632-1: 86484-1-PBS capture and 86484-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3230

  Product name: Recombinant Rat B7-H4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 29-257 aa of NM_001024244.1

  Sequence: FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNSG

• Full Name: V-set domain containing T cell activation inhibitor 1
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: NM_001024244.1
• Gene Symbol: Vtcn1
• Gene ID (NCBI): 295322
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q501W4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

B7-H4, also named VTCN1, B7X, or B7S1, is a single-pass type I membrane protein, which contains two immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7-H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7-H4 is over-expressed in many cancers, including breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. The predicted molecular weight of B7‑H4 is 31 kDa. The glycosylated B7‑H4 is 50 to 80 kDa, and the non-glycosylated form is 28 kDa.