B7-H6 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00851-2

  Sandwich ELISA standard curve of MP00851-2, Human B7-H6 Recombinant Matched Antibody Pair - PBS only. 83908-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg0007. 83908-5-PBS was HRP conjugated as the detection antibody. Range: 62.5-4000 pg/mL.

• 

  Sample test of MP00851-2

  Serum of sixteen individual healthy human donors was measured. The B7-H6 concentration of detected samples was determined to be 253.6 pg/mL with a range of 110.6 - 790.9 pg/mL.

B7-H6 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83908-1-PBS

Clone No.240808C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

B7H6, NCR3LG1, B7 H6, B7 homolog 6, Natural cytotoxicity triggering receptor 3 ligand 1

---

Product Information

83908-1-PBS targets B7-H6 as part of a matched antibody pair:

MP00851-2: 83908-1-PBS capture and 83908-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0007

  Product name: Recombinant Human B7-H6 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 25-262 aa of BC136800

  Sequence: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS

• Full Name: hypothetical protein DKFZp686O24166
• Calculated Molecular Weight: 51 kDa
• GenBank Accession Number: BC136800
• Gene Symbol: B7H6
• Gene ID (NCBI): 374383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q68D85
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.