BAD Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BAD Polyclonal antibody (10435-1-AP)

BAD Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 10435-1-AP

Publications(128)

Reviews (5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (4)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

BBC2, BBC6, Bcl2-associated agonist of cell death, Bcl-2-binding component 6, BCL2L8

• 

  WB analysis using 10435-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10435-1-AP (BAD antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10435-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10435-1-AP (BAD antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate hyperplasia using 10435-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 10435-1-AP (BAD Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 10435-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 10435-1-AP (BAD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 10435-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 10435-1-AP (BAD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate hyperplasia using 10435-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 10435-1-AP (BAD Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 10435-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10435-1-AP (BAD Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lymphoma using 10435-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10435-1-AP (BAD Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10435-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10435-1-AP (BAD antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10435-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10435-1-AP (BAD antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10435-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BAD antibody (10435-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Jurkat using 10435-1-AP

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human BAD (10435-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, Neuro-2a cells, L02 cells, NIH/3T3 cells
• Positive IHC detected in: human prostate hyperplasia tissue, human prostate cancer tissue, mouse liver tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:100-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10435-1-AP targets BAD in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig, canine, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0688

  Product name: Recombinant human BAD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-168 aa of BC001901

  Sequence: DSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ

• Full Name: BCL2-associated agonist of cell death
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18-25 kDa
• GenBank Accession Number: BC001901
• Gene Symbol: BAD
• Gene ID (NCBI): 572
• RRID: AB_2061994
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92934
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAD, also named as BBC6 and BCL2L8, promotes cell death. It is successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. BAD can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2. It appears to act as a link between growth factor receptor signaling and the apoptotic pathways.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Carbohydr Polym; A multi-bioresponsive self-assembled nano drug delivery system based on hyaluronic acid and geraniol against liver cancer; Authors - Shaofeng Duan
human	WB	Oxid Med Cell Longev; Cystathionine β-Synthase Regulates the Proliferation, Migration, and Invasion of Thyroid Carcinoma Cells.; Authors - Qi-Ying Jiang
human	WB	Oxid Med Cell Longev; Dihydroartemisinin Modulates Apoptosis and Autophagy in Multiple Myeloma through the P38/MAPK and Wnt/β-Catenin Signaling Pathways.; Authors - Xiuhua Wu
human	WB	Int J Nanomedicine; Synergism of cisplatin-oleanolic acid co-loaded calcium carbonate nanoparticles on hepatocellular carcinoma cells for enhanced apoptosis and reduced hepatotoxicity.; Authors - Muhammad Waseem Khan
human	WB	Cell Death Dis; CRB3 regulates contact inhibition by activating the Hippo pathway in mammary epithelial cells.; Authors - Xiaona Mao
human	WB	Int J Oncol; CUDC‑101 is a potential target inhibitor for the EGFR‑overexpression bladder cancer cells; Authors - Zhenxing Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

balawant (Verified Customer) (08-02-2026)

Excellent product with reliable quality. The antibody arrived well packaged, and the manufacturer's documentation was clear and helpful. We are pleased with our overall experience and would recommend this product to other researchers.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mice tissue

Mounika (Verified Customer) (03-24-2026)

Amazing antibody, excellent output!

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:1000

Sai Sindhura (Verified Customer) (01-08-2026)

BAD is very good antibody

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000

Mounika (Verified Customer) (01-08-2026)

Wonderful and best antibodies, easy to work with!

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:400

Carly (Verified Customer) (11-17-2020)

Tested using EDTA plasma on an antibody microarray

• Applications: Other