Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, Neuro-2a cells, L02 cells, NIH/3T3 cells |
| Positive IHC detected in | human prostate hyperplasia tissue, human prostate cancer tissue, mouse liver tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10435-1-AP targets BAD in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, canine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0688 Product name: Recombinant human BAD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-168 aa of BC001901 Sequence: DSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ Predict reactive species |
| Full Name | BCL2-associated agonist of cell death |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 18-25 kDa |
| GenBank Accession Number | BC001901 |
| Gene Symbol | BAD |
| Gene ID (NCBI) | 572 |
| RRID | AB_2061994 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92934 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BAD, also named as BBC6 and BCL2L8, promotes cell death. It is successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. BAD can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2. It appears to act as a link between growth factor receptor signaling and the apoptotic pathways.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for BAD antibody 10435-1-AP | Download protocol |
| IF protocol for BAD antibody 10435-1-AP | Download protocol |
| IHC protocol for BAD antibody 10435-1-AP | Download protocol |
| WB protocol for BAD antibody 10435-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
BAD Polyclonal antibody (Cat# 10435-1-AP) has accumulated 128 citations published in journals including Nature Communications, Science Advances, Cell Reports Medicine, Oncogene, Cancer Letters, Cell Death & Disease, Redox Biology, Journal of Experimental & Clinical Cancer Research, Stem Cell Research & Therapy, and many others. Associated research fields span apoptosis, oncology (breast, liver, lung, colorectal, gastric, thyroid, prostate, leukemia, myeloma), signaling pathways (PI3K/AKT/mTOR, MAPK, NF-κB, Wnt/β-catenin), drug pharmacology, neurodegeneration, cardiovascular disease, ischemia-reperfusion injury, and diabetes.
| Species | Application | Title |
|---|---|---|
Nat Commun Excessive serine from the bone marrow microenvironment impairs megakaryopoiesis and thrombopoiesis in Multiple Myeloma | ||
J Adv Res High throughput screening identifies sanguinarine chloride as a multi-faceted therapeutic agent for PRCC-TFE3 rRCC by targeting lactylation-driven VEGFB-VEGFR2 signaling and PMN-MDSC infiltration. | ||
Redox Biol Prenylterphenyllin, a regulator of P53, inhibits colorectal cancer progression through oxidative stress and energy metabolism pathway. | ||
J Exp Clin Cancer Res Synthetic lethality of combined ULK1 defection and p53 restoration induce pyroptosis by directly upregulating GSDME transcription and cleavage activation through ROS/NLRP3 signaling | ||
Cell Rep Med FBXO3-mediated DUSP9 ubiquitination promotes leukemia stem cell maintenance and tyrosine kinase inhibitor resistance in chronic myeloid leukemia. | ||
Reviews
What customers say
All five reviewers rate this antibody highly (average 4.8/5). Users consistently praise its performance across Western Blot, IHC, and IF applications, describing it as reliable, easy to work with, and producing excellent results at dilutions of 1:400–1:1000. One reviewer highlighted the clear documentation and well-packaged delivery. Another tested it on an antibody microarray with EDTA plasma. Overall, customers express strong satisfaction and recommend the product to other researchers.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
balawant (Verified Customer) (08-02-2026) | Excellent product with reliable quality. The antibody arrived well packaged, and the manufacturer's documentation was clear and helpful. We are pleased with our overall experience and would recommend this product to other researchers.
|
Mounika (Verified Customer) (03-24-2026) | Amazing antibody, excellent output!
|
Sai Sindhura (Verified Customer) (01-08-2026) | BAD is very good antibody
|
Mounika (Verified Customer) (01-08-2026) | Wonderful and best antibodies, easy to work with!
|
Carly (Verified Customer) (11-17-2020) | Tested using EDTA plasma on an antibody microarray
|
