Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
27215-1-AP targets BAF53B in WB, ELISA applications and shows reactivity with mouse, rat samples.
Tested Reactivity | mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25745 Product name: Recombinant human ACTL6B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-82 aa of BC020944 Sequence: TVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM Predict reactive species |
Full Name | actin-like 6B |
Calculated Molecular Weight | 47 kDa |
Observed Molecular Weight | 47-53 kDa |
GenBank Accession Number | BC020944 |
Gene Symbol | BAF53B |
Gene ID (NCBI) | 51412 |
RRID | AB_2857952 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O94805 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BAF53B, also named as ACTL6B, encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. BAF53b is unique among nucleosome remodeling complex subunits because it is neuron specific and is not found in any other nucleosome remodeling complex besides the nBAF complex(PMID: 23525042). BAF53B can be detected as about 47-53 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for BAF53B antibody 27215-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |