Tested Applications
| Positive IHC detected in | mouse brain tissue, rat brain tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30046-1-AP targets BAHCC1 in IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32599 Product name: Recombinant human BAHCC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1518-1614 aa of NM_001291324.1 Sequence: SLGLLCAELRGGSGGEPAKKRSKLERSVYAGLQTASVEKAQCKKSSCQGGLAPSVAHRVAQLKPKVKSKGLPTGLSSFQQKEATPGGRIREKLSRAK Predict reactive species |
| Full Name | BAH domain and coiled-coil containing 1 |
| Calculated Molecular Weight | 280 kDa |
| Observed Molecular Weight | 280 kDa |
| GenBank Accession Number | NM_001291324.1 |
| Gene Symbol | BAHCC1 |
| Gene ID (NCBI) | 57597 |
| RRID | AB_3086218 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9P281 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BAHCC1 (BAH and coiled-coil domain-containing protein 1) is also named as BAHD2, KIAA1447 and BAH domain-containing protein 2. BAHCC1 is a transcriptional regulator controlling expression of E2F/KLF-dependent cell-cycle and DNA-repair genes. BAHCC1 associates with BRG1-containing remodeling complexes at the promoters of these genes. BAHCC1 silencing leads to decreased cell proliferation and delayed DNA repair. Consequently, BAHCC1 deficiency cooperates with PARP inhibition to induce melanoma cell death (PMID: 37924516). depletion of BAHCC1, or disruption of the BAHCC1BAH-H3K27me3 interaction, causes derepression of H3K27me3-targeted genes that are involved in tumor suppression and cell differentiation, leading to suppression of oncogenesis (PMID: 33139953).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BAHCC1 antibody 30046-1-AP | Download protocol |
| IHC protocol for BAHCC1 antibody 30046-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |















