BAK Polyclonal antibody

• 

  WB analysis using 29552-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29552-1-AP (BAK antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29552-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29552-1-AP (BAK antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 29552-1-AP

  WB result of BAK antibody (29552-1-AP; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BAK transfected A431 cells.

• 

  IP experiment of A431 using 29552-1-AP

  IP result of anti-BAK (IP:29552-1-AP, 4ug; Detection:29552-1-AP 1:3000) with A431 cells lysate 1040 ug.

• 

  IHC staining of human colon cancer using 29552-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29552-1-AP (BAK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 29552-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29552-1-AP (BAK antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 29552-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using BAK antibody (29552-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

BAK Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 29552-1-AP

Publications(24)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

BAK1, Bcl-2 homologous antagonist/killer, Bcl2-L-7, Bcl-2-like protein 7, CDN1

---

Tested Applications

• Positive WB detected in: A431 cells, Neuro-2a cells, HEK-293 cells, HepG2 cells, Jurkat cells, MOLT-4 cells, 4T1 cells, ROS1728 cells
• Positive IP detected in: A431 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 22 publications below
• IHC: See 4 publications below

Product Information

29552-1-AP targets BAK in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31042

  Product name: Recombinant human BAK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_001188

  Sequence: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL

• Full Name: BCL2-antagonist/killer 1
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: NM_001188
• Gene Symbol: BAK1
• Gene ID (NCBI): 578
• RRID: AB_2923596
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16611
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Apoptosis; Investigation of GPR143 as a promising novel marker for the progression of skin cutaneous melanoma through bioinformatic analyses and cell experiments; Authors - Ruimin Bai
human	WB	Life Sci; A novel antimycin analogue antimycin A2c, derived from marine Streptomyces sp., suppresses HeLa cells via disrupting mitochondrial function and depleting HPV oncoproteins E6/E7; Authors - Weiyi Zhang
human	WB	Mar Drugs; Astaxanthin Inhibits H2O2-Induced Excessive Mitophagy and Apoptosis in SH-SY5Y Cells by Regulation of Akt/mTOR Activation; Authors - Tingting Yan
chicken	WB	Poult Sci; HSP60 inhibits DF-1 apoptosis through its mitochondrial signal peptide; Authors - Shengliang Cao
mouse	WB	Cell Metab; Muscle-derived small extracellular vesicles induce liver fibrosis during overtraining; Authors - Ya Liu
human	WB	Cell Biochem Biophys; MiR-218 Exhibits Anti-Leukemia Effects by Targeting CTNND2 in Primary Acute Erythroid Leukemia HEL Cells; Authors - Ming-Qiang Chu