BAK Polyclonal antibody, PBS Only

• 

  WB analysis using 29552-1-AP (same clone as 29552-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29552-1-AP (BAK antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29552-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29552-1-AP (same clone as 29552-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29552-1-AP (BAK antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29552-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 29552-1-AP (same clone as 29552-1-PBS)

  WB result of BAK antibody (29552-1-AP; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BAK transfected A431 cells. This data was developed using the same antibody clone with 29552-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A431 using 29552-1-AP (same clone as 29552-1-PBS)

  IP result of anti-BAK (IP:29552-1-AP, 4ug; Detection:29552-1-AP 1:3000) with A431 cells lysate 1040 ug. This data was developed using the same antibody clone with 29552-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29552-1-AP (same clone as 29552-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29552-1-AP (BAK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29552-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29552-1-AP (same clone as 29552-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29552-1-AP (BAK antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29552-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 29552-1-AP (same clone as 29552-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using BAK antibody (29552-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29552-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BAK Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 29552-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

BAK1, Bcl-2 homologous antagonist/killer, Bcl2-L-7, Bcl-2-like protein 7, CDN1

---

Product Information

29552-1-PBS targets BAK in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31042

  Product name: Recombinant human BAK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_001188

  Sequence: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL

• Full Name: BCL2-antagonist/killer 1
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: NM_001188
• Gene Symbol: BAK1
• Gene ID (NCBI): 578
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16611
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.