BAK Polyclonal antibody

• 

  WB analysis using 30017-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30017-1-AP (BAK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30017-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30017-1-AP (BAK antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 30017-1-AP

  IP result of anti-BAK (IP:30017-1-AP, 4ug; Detection:30017-1-AP 1:6000) with HEK-293 cells lysate 1640 ug.

• 

  IF Staining of HeLa using 30017-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using BAK antibody (30017-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

BAK Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 30017-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IF/ICC, IP, ELISA

Synonyms

BAK1, CDN1, Bcl-2-like protein 7, Bcl2-L-7, Bcl-2 homologous antagonist/killer

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Neuro-2a cells, PC-12 cells, HeLa cells, THP-1 cells
• Positive IP detected in: HEK-293 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30017-1-AP targets BAK in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: duck
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27958

  Product name: Recombinant human BAK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-124 aa of BC004431

  Sequence: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGIN

• Full Name: BCL2-antagonist/killer 1
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: BC004431
• Gene Symbol: BAK1
• Gene ID (NCBI): 578
• RRID: AB_3086211
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16611
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
duck	WB	J Virol; Duck Tembusu virus NS3 protein induces apoptosis by activating the PERK/PKR pathway and mitochondrial pathway; Authors - Yuhong Pan