Product Information
60446-1-PBS targets BAK as part of a matched antibody pair:
MP50602-1: 60446-1-PBS capture and 60446-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag31034 Product name: Recombinant human BAK protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_001188 Sequence: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL Predict reactive species |
Full Name | BCL2-antagonist/killer 1 |
Calculated Molecular Weight | 23 kDa |
GenBank Accession Number | NM_001188 |
Gene Symbol | BAK1 |
Gene ID (NCBI) | 578 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q16611 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |