Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

BAP31 Polyclonal antibody

BAP31 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

BCAP31, 6C6 AG, 6C6-AG tumor-associated antigen, B-cell receptor-associated protein 31, BCR-associated protein 31

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for BAP31 in ?

Tested Applications

Positive WB detected inA431 cells, HEK-293 cells, HeLa cells, MCF-7 cells, THP-1 cells, mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tisssue
Positive IP detected inA431 cells
Positive IHC detected inhuman breast cancer tissue, human colon tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, U2OS cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11200-1-AP targets BAP31 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1668

Product name: Recombinant human BCAP31 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-246 aa of BC014323

Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIREYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Predict reactive species
Full Name B-cell receptor-associated protein 31
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC014323
Gene Symbol BAP31
Gene ID (NCBI) 10134
RRIDAB_2065142
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP51572
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAP31, also known as BCAP31, is a chaperone protein abundant in the endoplasmic reticulum (ER). BAP31 plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded proteins, and their targeting to the ER-associated-degradation (ERAD). CDIP1 and BAP31 interact upon ER stress to regulate the mitochondrial apoptosis pathway(PMID: 24139803). It also serves as a cargo receptor for the export of transmembrane proteins. BAP31 may be involved in apoptosis.

Protocols

Product Specific Protocols
FC protocol for BAP31 antibody 11200-1-APDownload protocol
IF protocol for BAP31 antibody 11200-1-APDownload protocol
IHC protocol for BAP31 antibody 11200-1-APDownload protocol
IP protocol for BAP31 antibody 11200-1-APDownload protocol
WB protocol for BAP31 antibody 11200-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The BAP31 Polyclonal antibody (Cat# 11200-1-AP) has 37 citations published in journals including Science, Nature Biotechnology, Nature Methods, Nature Communications, EMBO Journal, Cell Death & Disease, Free Radical Biology and Medicine, Journal of Biological Chemistry, and International Journal of Molecular Sciences. Research fields encompass ER-mitochondria contact sites, endoplasmic reticulum stress, apoptosis, neurodegeneration, cancer biology, liver injury, cardiotoxicity, innate immunity, protein translation, lipid droplet biogenesis, and proximity labeling methodologies.

SpeciesApplicationTitle
mouseIF

Science

Mammalian oocytes store mRNAs in a mitochondria-associated membraneless compartment

Authors - Shiya Cheng
WB

Nat Biotechnol

Efficient proximity labeling in living cells and organisms with TurboID.

Authors - Tess C Branon
humanWB

Nat Methods

Directed evolution of APEX2 for electron microscopy and proximity labeling.

Authors - Stephanie S Lam
humanWB

Nat Commun

HDLBP binds ER-targeted mRNAs by multivalent interactions to promote protein synthesis of transmembrane and secreted proteins.

Authors - Ulrike Zinnall
humanWB,IP

Nat Commun

The EMC acts as a chaperone for membrane proteins

Authors - Carolin J Klose
WB

Cell Death Dis

BAP31 represses endoplasmic reticulum stress-mediated apoptosis and alleviates neurodegeneration in Parkinson's disease

Authors - Yan Qin

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Boyan Zhang) gave a 5-star rating for this antibody used in immunofluorescence. They reported that it clearly labeled the ER area. The review was posted on November 2, 2020, using lot 00018537.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Boyan (Verified Customer) (11-02-2020)

This antibody labeled the ER area clearly

  • Applications: Immunofluorescence
Loading...
||
New chat

Able™

正在加载,请稍候...