• Featured Product
  • KD/KO Validated

Cardinal Red™-conjugated BAP31 Polyclonal antibody

BAP31 Polyclonal Antibody for FC (Intra)
Cat No. CR-11200

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

BCAP31, 6C6 AG, 6C6-AG tumor-associated antigen, B-cell receptor-associated protein 31, BCR-associated protein 31

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CR-11200 targets BAP31 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1668

Product name: Recombinant human BCAP31 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-246 aa of BC014323

Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIREYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

Predict reactive species
Full Name B-cell receptor-associated protein 31
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC014323
Gene Symbol BAP31
Gene ID (NCBI) 10134
RRIDAB_2934332
Conjugate Cardinal Red™ Fluorescent Dye
Excitation/Emission Maxima Wavelengths592 nm / 611 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP51572
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BAP31 is a chaperone protein that is abundant in the endoplasmic reticulum (ER). BAP31 plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). It also serves as a cargo receptor for the export of transmembrane proteins. BAP31 may be involved in apoptosis.

Protocols

Product Specific Protocols
FC protocol for Cardinal Red™ BAP31 antibody CR-11200Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...