BCAS2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68003-1-Ig (same clone as 68003-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 68003-1-Ig (BCAS2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68003-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 68003-1-Ig (same clone as 68003-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68003-1-Ig (BCAS2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68003-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 68003-1-Ig (same clone as 68003-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 68003-1-Ig (BCAS2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68003-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 68003-1-Ig (same clone as 68003-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 68003-1-Ig (BCAS2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68003-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68003-1-Ig (same clone as 68003-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BCAS2 antibody (68003-1-Ig, Clone: 2A12G1 ) at dilution of 1:2000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68003-1-PBS in a different storage buffer formulation.

BCAS2 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68003-1-PBS

Clone No.2A12G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Spliceosome-associated protein SPF 27, Pre-mRNA-splicing factor SPF27, Pre mRNA splicing factor SPF27, DAM1, Breast carcinoma-amplified sequence 2

---

Product Information

68003-1-PBS targets BCAS2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21309

  Product name: Recombinant human BCAS2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-225 aa of BC005285

  Sequence: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

• Full Name: breast carcinoma amplified sequence 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC005285
• Gene Symbol: BCAS2
• Gene ID (NCBI): 10286
• RRID: AB_2918750
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75934
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Breast carcinoma amplified sequence 2 (BCAS2) is preferentially known as pre-mRNA splicing factor SPF27 and was originally characterized as an up-regulated gene by amplification in human breast cancer cells. BCAS2 has been shown to be involved in DNA damage repair through the replication protein A (RPA) complex.