BCL11A Recombinant monoclonal antibody

• 

  WB analysis using 84930-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84930-3-RR (BCL11A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 84930-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84930-3-RR (BCL11A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Jurkat using 84930-3-RR

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using BCL11A antibody (84930-3-RR, Clone: 242481F2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 84930-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84930-3-RR against Human BCL11A were performed. The affinity constant is 1.38 nM.

BCL11A Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84930-3-RR

Clone No.242481F2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

242481F2, B cell lymphoma/leukaemia 11A, B-cell CLL/lymphoma 11A, B-cell lymphoma/leukemia 11A, BCL-11A

---

Tested Applications

• Positive WB detected in: Jurkat cells, Daudi cells, Raji cells, MOLT-4 cells
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84930-3-RR targets BCL11A in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2187

  Product name: Recombinant human BCL11A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC021098

  Sequence: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPRVGIPSGLGAECPSQPPLHGIHIADNNPFNLLRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIERLGAEEMALATHHPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGSK

• Full Name: B-cell CLL/lymphoma 11A (zinc finger protein)
• Calculated Molecular Weight: 835 aa, 91 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC021098
• Gene Symbol: BCL11A
• Gene ID (NCBI): 53335
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H165
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.