BFL-1/A1 Polyclonal antibody

• 

BCL2A1 Polyclonal Antibody for ELISA

Cat No. 12223-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ACC 1, ACC 2, BCL2A1, BFL1, GRS, HBPA1, Protein BFL 1, Protein GRS

---

Published Applications

• WB: See 2 publications below

Product Information

12223-1-AP targets BCL2A1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2844

  Product name: Recombinant human BCL2A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-175 aa of BC016281

  Sequence: MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC

• Full Name: BCL2-related protein A1
• Calculated Molecular Weight: 175 aa, 20 kDa
• GenBank Accession Number: BC016281
• Gene Symbol: BCL2A1
• Gene ID (NCBI): 597
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16548
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Hepatology; Acetyl-CoA carboxylase α promotion of glucose-mediated fatty acid synthesis enhances survival of hepatocellular carcinoma in mice and patients.; Authors - Ming-Da Wang
human	WB	Apoptosis; The miR-573/apoM/Bcl2A1-dependent signal transduction pathway is essential for hepatocyte apoptosis and hepatocarcinogenesis.; Authors - Yan-Wei Hu