BCL2L2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BCL2L2 Polyclonal antibody (16026-1-AP)

BCL2L2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16026-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Apoptosis regulator Bcl W, BCL2L2, KIAA0271

• 

  WB analysis of HL-60 using 16026-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 16026-1-AP (BCL2L2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16026-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16026-1-AP (BCL2L2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16026-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16026-1-AP (BCL2L2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BCL2L2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16026-1-AP targets BCL2L2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8863

  Product name: Recombinant human BCL2L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-171 aa of BC021198

  Sequence: MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR

• Full Name: BCL2-like 2
• Calculated Molecular Weight: 193 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC021198
• Gene Symbol: BCL2L2
• Gene ID (NCBI): 599
• RRID: AB_2827646
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92843
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The BCL2L2 (Bcl-xL) antibody (Cat# 16026-1-AP) has 17 citations across journals including Nature Communications, Int J Mol Sci, Cell Signal, Exp Neurol, Cancers, iScience, Front Neurosci, Eur J Pharmacol, Neural Regen Res, Oxid Med Cell Longev, Basic Clin Pharmacol Toxicol, Exp Eye Res, PLoS One, Tumour Biol, Cancer Inform, and Transl Cancer Res. Research fields span apoptosis, senescence, neurovascularization, ferroptosis, oxidative stress, and multiple cancer types.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Nat Commun; Targeting anti-apoptotic pathways eliminates senescent melanocytes and leads to nevi regression; Authors - Jaskaren Kohli
mouse	WB	Neural Regen Res; Mechanism of piR-1245/PIWI-like protein-2 regulating Janus kinase-2/signal transducer and activator of transcription-3/vascular endothelial growth factor signaling pathway in retinal neovascularization; Authors - Yong Yu
human	WB	Oxid Med Cell Longev; Peptides Isolated from Yak Milk Residue Exert Antioxidant Effects through Nrf2 Signal Pathway.; Authors - Feiyan Yang
rat	WB	Eur J Pharmacol; GSK-3β-mediated activation of NLRP3 inflammasome leads to pyroptosis and apoptosis of rat cardiomyocytes and fibroblasts.; Authors - Shu-Hui Wang
Rat	WB	Int J Mol Sci; Role of Orai3-Mediated Store-Operated Calcium Entry in Radiation-Induced Brain Microvascular Endothelial Cell Injury; Authors - Qibing Wu
human	WB	Int J Mol Sci; Targeting Bcl-xL with Navitoclax Effectively Eliminates Senescent Tumor Cells That Appear Following CEP-1347-Induced Differentiation of Glioma Stem Cells; Authors - Senri Takenouchi