BCL9L Polyclonal antibody

• 

  WB analysis using 32103-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32103-1-AP (BCL9L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 32103-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using BCL9L antibody (32103-1-AP) at dilution of 1:800 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

BCL9L Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 32103-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Nuclear Co-Factor Of Beta-Catenin Signalling, DLNB11, BCL9-like protein, B-cell lymphoma 9-like protein, B-cell CLL/lymphoma 9-like protein

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, MCF-7 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32103-1-AP targets BCL9L in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36794

  Product name: Recombinant human BCL9L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 38-206 aa of NM_182557

  Sequence: MHPENKLTNHGKTGNGGAQSQHQNVNQGPTCNVGSKGVGAGNHGAKANQISPSNSSLKNPQAGVPPFSSLKGKVKRDRSVSVDSGEQREAGTPSLDSEAKEVAPRSKRRCVLERKQPYSGDEWCSGPDSEEDDKPIGATHNCNVADPAMAAPQLGPGQTTQLPLSESSV

• Full Name: B-cell CLL/lymphoma 9-like
• Calculated Molecular Weight: 157 kDa
• Observed Molecular Weight: 220 kDa
• GenBank Accession Number: NM_182557
• Gene Symbol: BCL9L
• Gene ID (NCBI): 283149
• RRID: AB_3670192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86UU0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

B-cell CLL/lymphoma 9-like protein (BCL9L, also known as B9L, BCL9-2, and DLNB11) is a transcriptional regulator that acts as an activator, which locates in nucleolus and nucleoplasm (PMID: 33767438). It is predicted to be implicated in the WNT-β-catenin signaling pathway to regulate the progress of hepatocellular carcinoma, breast cancer, and colon cancer (PMID: 31440992; 34545187; 30698996).