BCLAF1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BCLAF1 Polyclonal antibody (26809-1-AP)

• Featured Product
• KD/KO Validated

BCLAF1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26809-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, RIP, ELISA

Synonyms

Bcl-2-associated transcription factor 1, BCLAF1 and THRAP3 family member 1, Btf, KIAA0164

• 

  WB analysis of Jurkat using 26809-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26809-1-AP (BCLAF1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 26809-1-AP

  WB result of BCLAF1 antibody (26809-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BCLAF1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 26809-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26809-1-AP (BCLAF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 26809-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26809-1-AP (BCLAF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 26809-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 26809-1-AP (BCLAF1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 26809-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 26809-1-AP (BCLAF1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 26809-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26809-1-AP (BCLAF1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 26809-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26809-1-AP (BCLAF1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 26809-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26809-1-AP (BCLAF1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BCLAF1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, MCF-7 cells
• Positive IHC detected in: mouse testis tissue, human colon tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26809-1-AP targets BCLAF1 in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25210

  Product name: Recombinant human BCLAF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 881-920 aa of BC132780

  Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE

• Full Name: BCL2-associated transcription factor 1
• Calculated Molecular Weight: 920 aa, 106 kDa
• Observed Molecular Weight: 145 kDa
• GenBank Accession Number: BC132780
• Gene Symbol: BCLAF1
• Gene ID (NCBI): 9774
• RRID: AB_2880642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYF8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa.

Publications

What published studies show

The anti-BCLAF1 antibody (Cat# 26809-1-AP) has 12 total citations. Citations appear in journals including Nucleic Acids Research, eLife, iScience, Journal of Ethnopharmacology, Aging, Translational Oncology, Oncology Research, Journal of Oncology, Biochemical and Biophysical Research Communications, Biochemical Genetics, and bioRxiv. Research fields span multiple cancer types (colorectal, bladder, hepatocellular, breast, gastric, renal cell, bile duct, AML), m6A RNA modification, immune response, glycolysis, metastasis, chemoresistance, redox homeostasis, gut microbiota, and spermatogenesis.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Nucleic Acids Res; The N6-methyladenosine RNA-binding protein YTHDF1 modulates the translation of TRAF6 to mediate the intestinal immune response.; Authors - Xin Zong
human	WB	J Ethnopharmacol; Huangqi Jianzhong decoction inhibits CRC invasion through the modulation of BCLAF1-mediated glycolysis.; Authors - Xinlu Liu
human	WB	Aging (Albany NY); LncRNA PVT1 accelerates malignant phenotypes of bladder cancer cells by modulating miR-194-5p/BCLAF1 axis as a ceRNA.; Authors - Mingwei Chen
human	WB,IHC,IF	Transl Oncol; Hsp90 Inhibitor STA9090 induced VPS35 related extracellular vesicle release and metastasis in hepatocellular carcinoma; Authors - Wenchong Tan ; KD Validated
		Oncol Res; BCL2-Associated Transcription Factor 1 Promotes SRC/Hypoxia-Inducible Factor 1 Subunit α-Mediated Cancer Stemness in Radioresistant Triple-Negative Breast Cancer.; Authors - Yu-Hao Huang
human	WB	J Oncol; The Comprehensive Analysis of N6-Methyadenosine Writer METTL3 and METTL14 in Gastric Cancer; Authors - Yiling Ge