BCLAF1 Polyclonal antibody

• 

  WB analysis of Jurkat using 26809-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26809-1-AP (BCLAF1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 26809-1-AP

  WB result of BCLAF1 antibody (26809-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BCLAF1 transfected HEK-293 cells.

• 

  WB analysis of MCF-7 using 26809-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26809-1-AP (BCLAF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 26809-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26809-1-AP (BCLAF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 26809-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 26809-1-AP (BCLAF1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 26809-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 26809-1-AP (BCLAF1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 26809-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26809-1-AP (BCLAF1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 26809-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26809-1-AP (BCLAF1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

BCLAF1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26809-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, RIP, ELISA

Synonyms

Bcl-2-associated transcription factor 1, BCLAF1 and THRAP3 family member 1, Btf, KIAA0164

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, MCF-7 cells
• Positive IHC detected in: mouse testis tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 7 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• RIP: See 1 publications below

Product Information

26809-1-AP targets BCLAF1 in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25210

  Product name: Recombinant human BCLAF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 881-920 aa of BC132780

  Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE

• Full Name: BCL2-associated transcription factor 1
• Calculated Molecular Weight: 920 aa, 106 kDa
• Observed Molecular Weight: 145 kDa
• GenBank Accession Number: BC132780
• Gene Symbol: BCLAF1
• Gene ID (NCBI): 9774
• RRID: AB_2880642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYF8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Nucleic Acids Res; The N6-methyladenosine RNA-binding protein YTHDF1 modulates the translation of TRAF6 to mediate the intestinal immune response.; Authors - Xin Zong
human	WB	Aging (Albany NY); LncRNA PVT1 accelerates malignant phenotypes of bladder cancer cells by modulating miR-194-5p/BCLAF1 axis as a ceRNA.; Authors - Mingwei Chen
human	WB,IHC,IF	Transl Oncol; Hsp90 Inhibitor STA9090 induced VPS35 related extracellular vesicle release and metastasis in hepatocellular carcinoma; Authors - Wenchong Tan ; KD Validated
mouse	WB	eLife; SRSF10 is essential for progenitor spermatogonia expansion by regulating alternative splicing; Authors - Wenbo Liu
human	WB	J Oncol; The Comprehensive Analysis of N6-Methyadenosine Writer METTL3 and METTL14 in Gastric Cancer; Authors - Yiling Ge
human	WB	Biochem Genet; BCLAF1 is Expressed as a Potential Anti-oncogene in Bile Duct Cancer; Authors - Yutong Zhou