Tested Applications
| Positive WB detected in | Jurkat cells, HEK-293 cells, MCF-7 cells |
| Positive IHC detected in | mouse testis tissue, human colon tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| RIP | See 1 publications below |
Product Information
26809-1-AP targets BCLAF1 in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25210 Product name: Recombinant human BCLAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 881-920 aa of BC132780 Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE Predict reactive species |
| Full Name | BCL2-associated transcription factor 1 |
| Calculated Molecular Weight | 920 aa, 106 kDa |
| Observed Molecular Weight | 145 kDa |
| GenBank Accession Number | BC132780 |
| Gene Symbol | BCLAF1 |
| Gene ID (NCBI) | 9774 |
| RRID | AB_2880642 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NYF8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BCLAF1 antibody 26809-1-AP | Download protocol |
| WB protocol for BCLAF1 antibody 26809-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res The N6-methyladenosine RNA-binding protein YTHDF1 modulates the translation of TRAF6 to mediate the intestinal immune response. | ||
Aging (Albany NY) LncRNA PVT1 accelerates malignant phenotypes of bladder cancer cells by modulating miR-194-5p/BCLAF1 axis as a ceRNA. | ||
Transl Oncol Hsp90 Inhibitor STA9090 induced VPS35 related extracellular vesicle release and metastasis in hepatocellular carcinoma
| ||
eLife SRSF10 is essential for progenitor spermatogonia expansion by regulating alternative splicing | ||
J Oncol The Comprehensive Analysis of N6-Methyadenosine Writer METTL3 and METTL14 in Gastric Cancer | ||

















