BCOR Polyclonal antibody

• 

  WB analysis using 12107-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12107-1-AP (BCOR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12107-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12107-1-AP (BCOR antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 12107-1-AP

  IP result of anti-BCOR (IP:12107-1-AP, 4ug; Detection:12107-1-AP 1:5000) with HEK-293 cells lysate 920 ug.

• 

  IHC staining of human breast cancer using 12107-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12107-1-AP (BCOR antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 12107-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12107-1-AP (BCOR antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

BCOR Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12107-1-AP

Publications(12)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, CoIP, ChIP, ELISA

Synonyms

ANOP2, BCOR, KIAA1575, MAA2, MCOPS2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 7 publications below
• IHC: See 3 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below
• ChIP: See 2 publications below

Product Information

12107-1-AP targets BCOR in WB, IHC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2752

  Product name: Recombinant human BCOR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-361 aa of BC009675

  Sequence: RFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLASDNYW

• Full Name: BCL6 co-repressor
• Calculated Molecular Weight: 1703 aa, 186 kDa
• Observed Molecular Weight: 186 kDa
• GenBank Accession Number: BC009675
• Gene Symbol: BCOR
• Gene ID (NCBI): 54880
• RRID: AB_2290335
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6W2J9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCOR, a corepressor of BCL6, binds to transcriptional factors and specifically inhibits gene expression. BCOR plays a key role in the early embryonic development, mesenchymal stem cell function and hematopiesis. BCOR can associate with HDACs, the polycomb group protein, polycomb group Ring finger protein1/nervous system polycomb1 (PCGF1/NSPC1), histone demethylase, F-box- and leucine-rich repeat protein10(FBXL10). Via repression of TFAP2A acts as a negative regulator of osteo-dentiogenic capacity in adult stem

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB, IHC	Nat Genet; Consistent in-frame internal tandem duplications of BCOR characterize clear cell sarcoma of the kidney.; Authors - Hitomi Ueno-Yokohata
human	WB	Blood; Epigenetic Regulation of Non-canonical Menin Targets Modulates Menin Inhibitor Response in Acute Myeloid Leukemia; Authors - Xinyue Zhou
human,mouse		Mol Cell; Non-canonical PRC1.1 licenses transcriptional response to enable Treg plasticity in immune adaptation; Authors - Ting Li
human	WB	Nucleic Acids Res; Bimodal regulation of the PRC2 complex by USP7 underlies tumorigenesis.; Authors - Dongxue Su
mouse	WB	Int J Mol Sci; BCOR Internal Tandem Duplication Expression in Neural Stem Cells Promotes Growth, Invasion, and Expression of PRC2 Targets.; Authors - Satoshi Nakata
mouse	WB	Sci Rep; Loss of Polycomb Group Protein Pcgf1 Severely Compromises Proper Differentiation of Embryonic Stem Cells.; Authors - Yun Yan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Sid (Verified Customer) (05-13-2019)

Works well for mouse hematopoetic cells, some strong non specific bands ~ 150 kD and ~100 kD, however can be reasonably resolved on 4-15% gel.

• Applications: Western Blot,
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: Mouse hematopoetic