Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, K-562 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12107-1-AP targets BCOR in WB, IHC, IP, CoIP, ChIP, ELISA, CUT&RUN applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2752 Product name: Recombinant human BCOR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-361 aa of BC009675 Sequence: RFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLASDNYW Predict reactive species |
| Full Name | BCL6 co-repressor |
| Calculated Molecular Weight | 1703 aa, 186 kDa |
| Observed Molecular Weight | 186 kDa |
| GenBank Accession Number | BC009675 |
| Gene Symbol | BCOR |
| Gene ID (NCBI) | 54880 |
| RRID | AB_2290335 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6W2J9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BCOR, a corepressor of BCL6, binds to transcriptional factors and specifically inhibits gene expression. BCOR plays a key role in the early embryonic development, mesenchymal stem cell function and hematopiesis. BCOR can associate with HDACs, the polycomb group protein, polycomb group Ring finger protein1/nervous system polycomb1 (PCGF1/NSPC1), histone demethylase, F-box- and leucine-rich repeat protein10(FBXL10). Via repression of TFAP2A acts as a negative regulator of osteo-dentiogenic capacity in adult stem
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BCOR antibody 12107-1-AP | Download protocol |
| IP protocol for BCOR antibody 12107-1-AP | Download protocol |
| WB protocol for BCOR antibody 12107-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The BCOR Polyclonal antibody (Cat# 12107-1-AP) has 18 citations. These appear in journals including Nature Genetics, Blood, Nature Communications, Molecular Cell, Nucleic Acids Research, Blood Cancer Discovery, Cell Reports, Cell Proliferation, Genetics, International Journal of Molecular Sciences, Scientific Reports, Journal of Pathology Clinical Research, Journal of Virology, and Journal of Clinical Pathology. Research fields span epigenetics and Polycomb (PRC1/PRC2) regulation, acute myeloid leukemia, sarcoma, stem cell differentiation, and viral reactivation, with applications in WB, IHC, ChIP, CoIP, IP, and CUT&RUN.
| Species | Application | Title |
|---|---|---|
Nat Genet Consistent in-frame internal tandem duplications of BCOR characterize clear cell sarcoma of the kidney. | ||
Blood Epigenetic Regulation of Non-canonical Menin Targets Modulates Menin Inhibitor Response in Acute Myeloid Leukemia | ||
Nat Commun PCGF1-PRC1 links chromatin repression with DNA replication during hematopoietic cell lineage commitment | ||
Mol Cell Non-canonical PRC1.1 licenses transcriptional response to enable Treg plasticity in immune adaptation | ||
Mol Cell SKP1A bound to Polycomb-silenced genes mediates degradation of PRC2 and preconditions their activation. | ||
Nucleic Acids Res Bimodal regulation of the PRC2 complex by USP7 underlies tumorigenesis. |
Reviews
What customers say
The antibody performs well for Western Blot on mouse hematopoietic cells at a 1:1000 dilution. Reviewers noted some strong non-specific bands around 150 kD and 100 kD, but these can be reasonably resolved using a 4–15% gel. Overall, the product received a 4-star rating, indicating good performance with minor non-specific binding that is manageable with appropriate gel conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sid (Verified Customer) (05-13-2019) | Works well for mouse hematopoetic cells, some strong non specific bands ~ 150 kD and ~100 kD, however can be reasonably resolved on 4-15% gel.
|
