BCOR Monoclonal antibody

• 

  WB analysis of SW480 using 68611-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68611-1-Ig (BCOR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68611-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68611-1-Ig (BCOR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 68611-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 68611-1-Ig (BCOR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 68611-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 68611-1-Ig (BCOR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

BCOR Monoclonal Antibody for WB, ELISA

Cat No. 68611-1-Ig

Clone No.1F12H6

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

WB, ELISA

Synonyms

ANOP2, BCOR, FLJ20285, FLJ38041, KIAA1575, MAA2, MCOPS2

---

Tested Applications

• Positive WB detected in: HeLa cells, SW480 cells, HEK-293 cells, RAW 264.7 cells, MCF-7 cells, Jurkat cells, MOLT-4 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68611-1-Ig targets BCOR in WB, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33785

  Product name: Recombinant human BCOR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2-361 aa of BC009675

  Sequence: RFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLASDNYW

• Full Name: BCL6 co-repressor
• Calculated Molecular Weight: 1703 aa, 186 kDa
• Observed Molecular Weight: 186-200 kDa
• GenBank Accession Number: BC009675
• Gene Symbol: BCOR
• Gene ID (NCBI): 54880
• RRID: AB_3085306
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6W2J9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCOR, a corepressor of BCL6, binds to transcriptional factors and specifically inhibits gene expression. BCOR plays a key role in the early embryonic development, mesenchymal stem cell function and hematopiesis. BCOR can associate with HDACs, the polycomb group protein, polycomb group Ring finger protein1/nervous system polycomb1 (PCGF1/NSPC1), histone demethylase, F-box- and leucine-rich repeat protein10(FBXL10). Via repression of TFAP2A acts as a negative regulator of osteo-dentiogenic capacity in adult stem.