BIK Monoclonal antibody, PBS Only

• 

  WB analysis using 68438-1-Ig (same clone as 68438-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68438-1-Ig (BIK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68438-1-PBS in a different storage buffer formulation.

BIK Monoclonal Antibody for WB, ELISA

Cat No. 68438-1-PBS

Clone No.1B1C10

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, ELISA

Synonyms

Apoptosis inducer NBK, BIK, BIP1, BP4, NBK

---

Product Information

68438-1-PBS targets BIK in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6353

  Product name: Recombinant human BIK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-134 aa of BC001599

  Sequence: MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCE

• Full Name: BCL2-interacting killer (apoptosis-inducing)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC001599
• Gene Symbol: BIK
• Gene ID (NCBI): 638
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13323
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins.