BIM, BCL2L11 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Cytometric bead array sample test of MP02863-1

  The mean BIM/BCL2L11 concentration was determined to be 4.4 ng/mL in Raji cell extract based on a 1.3 mg/mL extract load, 1.7 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02863-1

  Cytometric bead array standard curve of MP02863-1, BIM/BCL2L11 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 81976-3-PBS. Detection antibody: 81976-2-PBS. Standard: Ag11875. Range: 0.156-20 ng/mL.

BIM, BCL2L11 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 81976-2-PBS

Clone No.252250G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

BCL2L11, BAM, Bcl2-interacting mediator of cell death, Bcl2-L-11, BCL2L11, BIM

---

Product Information

81976-2-PBS targets BIM, BCL2L11 as part of a matched antibody pair:

MP02863-1: 81976-3-PBS capture and 81976-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11875

  Product name: Recombinant human BIM, BCL2L11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-198 aa of BC033694

  Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH

• Full Name: BCL2-like 11 (apoptosis facilitator)
• Calculated Molecular Weight: 198 aa, 22 kDa
• GenBank Accession Number: BC033694
• Gene Symbol: Bim
• Gene ID (NCBI): 10018
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43521
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.