Tested Applications
Positive WB detected in | Jurkat cells, Raji cells, SH-SY5Y cells |
Positive IP detected in | SH-SY5Y cells |
Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IP | See 1 publications below |
Product Information
10510-1-AP targets BLK in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0795 Product name: Recombinant human BLK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC007371 Sequence: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSL Predict reactive species |
Full Name | B lymphoid tyrosine kinase |
Calculated Molecular Weight | 58 kDa |
Observed Molecular Weight | 58 kDa |
GenBank Accession Number | BC007371 |
Gene Symbol | BLK |
Gene ID (NCBI) | 640 |
RRID | AB_2274754 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P51451 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tyrosine-protein kinase Blk(BLK) is typically involved in cell proliferation and differentiation.BLK is a 58 kDa protein with important role in B-cell receptor signaling and B-cell development. BLK also stimulates INS synthesis and secretion in response to glucose and enhances the expression of several pancreatic beta-cell transcription factors.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for BLK antibody 10510-1-AP | Download protocol |
IHC protocol for BLK antibody 10510-1-AP | Download protocol |
IP protocol for BLK antibody 10510-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Signal Transduct Target Ther B-lymphoid tyrosine kinase-mediated FAM83A phosphorylation elevates pancreatic tumorigenesis through interacting with β-catenin | ||
Cancer Cell Molecular targets of glucocorticoids that elucidate their therapeutic efficacy in aggressive lymphomas | ||
Diabet Med A novel BLK heterozygous mutation (p.Met121lle) in maturity-onset diabetes mellitus: A case report and literature review |