BLK Polyclonal antibody

• 

  WB analysis of Jurkat using 10510-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10510-1-AP (BLK antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 10510-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10510-1-AP (BLK antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 10510-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 10510-1-AP (BLK antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 10510-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 10510-1-AP (BLK Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of SH-SY5Y using 10510-1-AP

  IP result of anti-BLK (IP:10510-1-AP, 4ug; Detection:10510-1-AP 1:500) with SH-SY5Y cells lysate 1600ug.

• 

  IHC staining of human pancreas cancer using 10510-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10510-1-AP (BLK Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 10510-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10510-1-AP (BLK Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

BLK Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10510-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

B lymphocyte kinase, B lymphoid tyrosine kinase, EC:2.7.10.2, p55 Blk, p55-Blk

---

Tested Applications

• Positive WB detected in: Jurkat cells, Raji cells, SH-SY5Y cells
• Positive IP detected in: SH-SY5Y cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IP: See 1 publications below

Product Information

10510-1-AP targets BLK in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0795

  Product name: Recombinant human BLK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC007371

  Sequence: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSL

• Full Name: B lymphoid tyrosine kinase
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC007371
• Gene Symbol: BLK
• Gene ID (NCBI): 640
• RRID: AB_2274754
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51451
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tyrosine-protein kinase Blk(BLK) is typically involved in cell proliferation and differentiation.BLK is a 58 kDa protein with important role in B-cell receptor signaling and B-cell development. BLK also stimulates INS synthesis and secretion in response to glucose and enhances the expression of several pancreatic beta-cell transcription factors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Signal Transduct Target Ther; B-lymphoid tyrosine kinase-mediated FAM83A phosphorylation elevates pancreatic tumorigenesis through interacting with β-catenin; Authors - Cefan Zhou
human	WB	Cancer Cell; Molecular targets of glucocorticoids that elucidate their therapeutic efficacy in aggressive lymphomas; Authors - Jaewoo Choi
		Diabet Med; A novel BLK heterozygous mutation (p.Met121lle) in maturity-onset diabetes mellitus: A case report and literature review; Authors - Fenjuan Xu