BLVRA Polyclonal antibody, PBS Only

• 

  WB analysis using 10775-1-AP (same clone as 10775-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10775-1-AP (BLVRA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10775-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 10775-1-AP (same clone as 10775-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10775-1-AP (BLVRA antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10775-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 10775-1-AP (same clone as 10775-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 10775-1-AP (BLVRA antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10775-1-AP (same clone as 10775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10775-1-AP (BLVRA antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 10775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 10775-1-AP (same clone as 10775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 10775-1-AP (BLVRA antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 10775-1-AP (same clone as 10775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 10775-1-AP (BLVRA antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10775-1-AP (same clone as 10775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10775-1-AP (BLVRA antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10775-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10775-1-AP (same clone as 10775-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10775-1-AP (BLVRA antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10775-1-PBS in a different storage buffer formulation.

• 

  IF Staining of L02 using 10775-1-AP (same clone as 10775-1-PBS)

  Immunofluorescent analysis of L02 cells using 10775-1-AP (BLVRA antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10775-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BLVRA Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10775-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

10775-1-PBS targets BLVRA in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1166

  Product name: Recombinant human BLVRA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-296 aa of BC008456

  Sequence: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK

• Full Name: biliverdin reductase A
• Calculated Molecular Weight: 33.2 kDa
• Observed Molecular Weight: 37-40 kDa, 66 kDa
• GenBank Accession Number: BC008456
• Gene Symbol: BLVRA
• Gene ID (NCBI): 644
• RRID: AB_2065073
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53004
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BLVRA(Biliverdin reductase A) is also named as BLVR, BVR and belongs to the biliverdin reductase subfamily.It catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH.This protein can exsit as a dimer(PMID:11773068). Defects in BLVRA are the cause of hyperbiliverdinemia (HBLVD).