BMPR1B Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP00182-2

  J774A.1 mouse reticulum cell sarcoma macrophage cells (1 x 106 cells/mL) were cultured for 3 days in DMEM containing 10% fetal bovine serum. An aliquot of the cell culture supernatants were removed, assayed for mouse IL-6R alpha, and measured 402.5 pg/mL. Liver tissue from one mouse was homogenized and seeded into 100 mL of RPMI containing 10% fetal bovine serum, 2 mM L-glutamine, 100 U/mL penicillin, 100 μg/mL streptomycin sulfate, and 50 μM β-mercaptoethanol for 3 days. An aliquot of the cell culture supernate was removed, assayed for mouse IL-6R alpha, and measured 345.1 pg/mL.

• 

  Sandwich ELISA sample test of MP00182-2

  Serum of sixteen mice were measured. The IL-6R alpha concentration of detected samples was determined to be 10,180.3 pg/mL with a range of 6,065.2-15,362.2 pg/mL.

• 

  Sandwich ELISA standard curve of MP00182-2

  Sandwich ELISA standard curve of MP00182-2, Mouse CD126/IL-6R alpha Monoclonal Matched Antibody Pair - PBS only. 98024-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg0664. 83209-2-PBS was HRP conjugated as the detection antibody. Range: 62.5-4000 pg/mL.

BMPR1B Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 83029-3-PBS

Clone No.230244E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

BMP type 1B receptor, BMP type-1B receptor, BMPR 1B, BMPR-1B, Bone morphogenetic protein receptor type-1B

---

Product Information

83029-3-PBS targets BMPR1B in Sandwich ELISA, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Affinity:
  K_D=7.44 x 10^-11M
  K_Off=1.24 x 10^-4M
  K_On=1.67 x 10^6M
• Immunogen:

  CatNo: Ag24902

  Product name: Recombinant human BMPR1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-57 aa of BC047773

  Sequence: EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI

• Full Name: bone morphogenetic protein receptor, type IB
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: BC047773
• Gene Symbol: BMPR1B
• Gene ID (NCBI): 658
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00238
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.