Product Information
83029-3-PBS targets BMPR1B in Sandwich ELISA, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Affinity | KD=7.44 x 10-11M KOff=1.24 x 10-4M KOn=1.67 x 106M |
Immunogen |
CatNo: Ag24902 Product name: Recombinant human BMPR1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 16-57 aa of BC047773 Sequence: EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI Predict reactive species |
Full Name | bone morphogenetic protein receptor, type IB |
Calculated Molecular Weight | 57 kDa |
GenBank Accession Number | BC047773 |
Gene Symbol | BMPR1B |
Gene ID (NCBI) | 658 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O00238 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |