BRAP Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP00338-4

  Sandwich ELISA standard curve of MP00338-4, Human BRAP Recombinant Matched Antibody Pair - PBS only. 83314-5-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag26728. 83314-2-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL.

• 

  Sample test of MP00338-4

  The mean BRAP concentration was determined to be 5.53 ng/mL in HEK-293 cell extract based on a 1.20 mg/mL extract load and 10.64 ng/mL in HeLa cell extract based on a 1.20 mg/mL extract load.

BRAP Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83314-2-PBS

Clone No.240099H3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

BRAP2, BRCA1 associated protein, BRCA1-associated protein, EC:2.3.2.27, IMP

---

Product Information

83314-2-PBS targets BRAP as part of a matched antibody pair:

MP00338-4: 83314-5-PBS capture and 83314-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26728

  Product name: Recombinant human BRAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 376-535 aa of BC136698

  Sequence: RLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRD

• Full Name: BRCA1 associated protein
• Calculated Molecular Weight: 592 aa, 67 kDa
• GenBank Accession Number: BC136698
• Gene Symbol: BRAP
• Gene ID (NCBI): 8315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q7Z569
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.