BRD2 Polyclonal antibody

• 

  WB analysis using 22236-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22236-1-AP (BRD2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 22236-1-AP

  IP result of anti-BRD2 (IP:22236-1-AP, 4ug; Detection:22236-1-AP 1:5000) with HeLa cells lysate 1280 ug.

• 

  IHC staining of human stomach using 22236-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 22236-1-AP (BRD2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 22236-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BRD2 antibody (22236-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

BRD2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 22236-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

bromodomain containing 2, Bromodomain-containing protein 2, D6S113E, FSH, FSRG1

---

Tested Applications

• Positive WB detected in: HeLa cells, J774A. 1 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 10 publications below
• IP: See 1 publications below
• ChIP: See 1 publications below

Product Information

22236-1-AP targets BRD2 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17589

  Product name: Recombinant human BRD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 537-668 aa of BC063840

  Sequence: LSQGPISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFGPSGGSGTKLQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRLPKKATKTAPPALPTGYDS

• Full Name: bromodomain containing 2
• Calculated Molecular Weight: 836 aa, 92 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC063840
• Gene Symbol: BRD2
• Gene ID (NCBI): 6046
• RRID: AB_2722524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25440
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Med; Prostate cancer-associated SPOP mutations confer resistance to BET inhibitors through stabilization of BRD4.; Authors - Xiangpeng Dai
human	WB	Nat Commun; The H2A.Z and NuRD associated protein HMG20A controls early head and heart developmental transcription programs; Authors - Andreas Herchenröther
		Mol Cell; A di-acetyl-decorated chromatin signature couples liquid condensation to suppress DNA end synapsis; Authors - Kaiwen Bao
human	WB	Nat Commun; Stromal induction of BRD4 phosphorylation Results in Chromatin Remodeling and BET inhibitor Resistance in Colorectal Cancer.; Authors - Wenyu Wang
mouse	WB	J Neuroinflammation; The BET PROTAC inhibitor dBET6 protects against retinal degeneration and inhibits the cGAS-STING in response to light damage; Authors - Xingfei Zhu
human	WB	Front Oncol; The MYC Paralog-PARP1 Axis as a Potential Therapeutic Target in MYC Paralog-Activated Small Cell Lung Cancer.; Authors - Xing Bian ; KD Validated