Product Information
84190-3-PBS targets BST2 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg1961 Product name: Recombinant Human BST2 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 49-161 aa of BC033873 Sequence: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS Predict reactive species |
Full Name | bone marrow stromal cell antigen 2 |
Calculated Molecular Weight | 180 aa, 20 kDa |
GenBank Accession Number | BC033873 |
Gene Symbol | BST2 |
Gene ID (NCBI) | 684 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q10589 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |