BTG1 Polyclonal antibody

BTG1 Polyclonal Antibody for IHC, ELISA
Cat No. 14879-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

BTG1, Protein BTG1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman thyroid cancer tissue, human lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14879-1-AP targets BTG1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6651

Product name: Recombinant human BTG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-171 aa of BC064953

Sequence: MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG

Predict reactive species
Full Name B-cell translocation gene 1, anti-proliferative
Calculated Molecular Weight 19 kDa
GenBank Accession NumberBC064953
Gene Symbol BTG1
Gene ID (NCBI) 694
RRIDAB_2067644
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP62324
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BTG1 is a member of the TOB/BTG family of proteins known to inhibit cell proliferation and negatively regulate the cell cycle (PMID: 25017022). It is strongly expressed in quiescent cells (maximal in the G0/G1 phase) and down-regulated as the cells enter the growth cycle (PMID: 1373383). BTG1 protein is localized in cytoplasm and nucleus, and can interact with CAF1 and PRMT1 (PMID: 1113675, 9712883, 26622543). The aberration of BTG1 expression is associated with B-cell lymphocytic leukemia, and may serve as a diagnostic indicator and prognostic marker of thyroid carcinoma (PMID: 2069907, 25017022).

Protocols

Product Specific Protocols
IHC protocol for BTG1 antibody 14879-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
HUMANWB,IHC

Oncotarget

BTG1 expression correlates with pathogenesis, aggressive behaviors and prognosis of gastric cancer: a potential target for gene therapy.

Authors - Hua-chuan Zheng
humanIHC

Front Oncol

BTG1 Overexpression Might Promote Invasion and Metastasis of Colorectal Cancer via Decreasing Adhesion and Inducing Epithelial-Mesenchymal Transition.

Authors - Shuang Zhao
humanIHC

Front Oncol

Development and validation of a combined hypoxia and ferroptosis prognostic signature for breast cancer

Authors - Jianxin Zhong

Int J Mol Sci

BTG1 expression correlates with the pathogenesis and progression of ovarian carcinomas.

Authors - Yang Zhao
human,mouseWB,IF

J Cell Physiol

Long noncoding RNA DGCR5 suppresses gastric cancer progression by acting as a competing endogenous RNA of PTEN and BTG1.

Authors - Ying Xu
humanWB

Mol Med Rep

Exosomal microRNA-301a-3p promotes the proliferation and invasion of nasopharyngeal carcinoma cells by targeting BTG1 mRNA

Authors - QIANG CHENG
Loading...
||
New chat Able
正在加载,请稍候...