BXDC1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68192-1-Ig (same clone as 68192-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68192-1-Ig (BXDC1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68192-1-PBS in a different storage buffer formulation.

BXDC1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68192-1-PBS

Clone No.1D12F1

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

bA397G5.4, brix domain containing 1, BXDC1, FLJ21087, RPF2

---

Product Information

68192-1-PBS targets BXDC1 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11268

  Product name: Recombinant human BXDC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-297 aa of BC035314

  Sequence: MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHE

• Full Name: brix domain containing 1
• Calculated Molecular Weight: 306 aa, 36 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC035314
• Gene Symbol: BXDC1
• Gene ID (NCBI): 84154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H7B2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.