Product Information
85816-1-PBS targets Beta-2 microglobulin in Indirect ELISA applications and shows reactivity with rat samples.
| Tested Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3270 Product name: Recombinant Rat Beta-2-Microglobulin protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-119 aa of NM_012512.2 Sequence: IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM Predict reactive species |
| Full Name | beta-2 microglobulin |
| Calculated Molecular Weight | 14 kDa |
| GenBank Accession Number | NM_012512.2 |
| Gene Symbol | B2m |
| Gene ID (NCBI) | 24223 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P07151 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
