Tested Applications
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MDCK cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25583-1-AP targets C13orf30 in IHC, IF/ICC, ELISA applications and shows reactivity with human, canine samples.
| Tested Reactivity | human, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22353 Product name: Recombinant human C13orf30 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-139 aa of BC093659 Sequence: MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRKTSAMTRRCPSVLPVSVVLPRAQSKRRQVLRN Predict reactive species |
| Full Name | chromosome 13 open reading frame 30 |
| Calculated Molecular Weight | 139 aa, 16 kDa |
| GenBank Accession Number | BC093659 |
| Gene Symbol | C13orf30 |
| Gene ID (NCBI) | 144809 |
| RRID | AB_2880139 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N7L0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for C13orf30 antibody 25583-1-AP | Download protocol |
| IHC protocol for C13orf30 antibody 25583-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





