C13orf39 Polyclonal antibody

• 

  WB analysis using 26260-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26260-1-AP (C13orf39 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

C13orf39 Polyclonal Antibody for WB, ELISA

Cat No. 26260-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

C13orf39, UPF0567 protein C13orf39

---

Tested Applications

• Positive WB detected in: rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26260-1-AP targets C13orf39 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23418

  Product name: Recombinant human C13orf39 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 156-264 aa of BC132748

  Sequence: NTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPESSVKLFKGILKWD

• Full Name: chromosome 13 open reading frame 39
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC132748
• Gene Symbol: C13orf39
• Gene ID (NCBI): 196541
• RRID: AB_3669531
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VZV1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.