C14orf2 Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 14704-1-AP (same clone as 14704-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14704-1-AP (C14orf2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14704-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 14704-1-AP (same clone as 14704-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 14704-1-AP (C14orf2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14704-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 14704-1-AP (same clone as 14704-1-PBS)

  IP result of anti-C14orf2 (IP:14704-1-AP, 4ug; Detection:14704-1-AP 1:300) with Jurkat cells lysate 3360ug. This data was developed using the same antibody clone with 14704-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 14704-1-AP (same clone as 14704-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 14704-1-AP (C14orf2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14704-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 14704-1-AP (same clone as 14704-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 14704-1-AP (C14orf2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14704-1-PBS in a different storage buffer formulation.

C14orf2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 14704-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

14704-1-PBS targets C14orf2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6386

  Product name: Recombinant human C14orf2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-58 aa of BC001944

  Sequence: MLQSIIKNIWIPMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH

• Full Name: chromosome 14 open reading frame 2
• Calculated Molecular Weight: 7 kDa
• Observed Molecular Weight: 7 kDa
• GenBank Accession Number: BC001944
• Gene Symbol: C14orf2
• Gene ID (NCBI): 9556
• RRID: AB_2228192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56378
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.