C16orf13 Polyclonal antibody

• 

  WB analysis of mouse liver using 20801-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 20801-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 20801-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 20801-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 20801-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 20801-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 20801-1-AP (C16orf13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 20801-1-AP

  Immunofluorescent analysis of HeLa cells using 20801-1-AP (C16orf13 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

C16orf13 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 20801-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

METTL26, Methyltransferase-like 26, JFP2

---

Tested Applications

• Positive WB detected in: mouse liver tissue, HeLa cells, rat liver tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20801-1-AP targets C16orf13 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14718

  Product name: Recombinant human C16orf13 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-107 aa of BC007207

  Sequence: MLVAAAAERNKDPILHVLRQYLDPAQRGVRVLEVASGSGQHAAHFARAFPLAEWQPSDVDQRCLDRNPEWGLRDTALLEDLGKASGLLLERMVDMPANNKCLIFRKN

• Full Name: chromosome 16 open reading frame 13
• Calculated Molecular Weight: 204 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC007207
• Gene Symbol: C16orf13
• Gene ID (NCBI): 84326
• RRID: AB_2878742
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96S19
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.