C16orf45 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 26037-1-AP (same clone as 26037-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26037-1-AP (C16orf45 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26037-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 26037-1-AP (same clone as 26037-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 26037-1-AP (C16orf45 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26037-1-PBS in a different storage buffer formulation.

C16orf45 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26037-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

26037-1-PBS targets C16orf45 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22584

  Product name: Recombinant human C16orf45 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 147-204 aa of BC008967

  Sequence: EMADFLRIKLKPLDKVTKSPASSRAEKKAEPPPSKPTVAKTGLALIKDCCGATQCNIM

• Full Name: chromosome 16 open reading frame 45
• Observed Molecular Weight: 24-26 kDa
• GenBank Accession Number: BC008967
• Gene Symbol: C16orf45
• Gene ID (NCBI): 89927
• RRID: AB_2880346
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MC5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.